DPCstruct | MC22328
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 157 ± 37 aa |
| Standard deviation of domain lengths | 37.38 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 79.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 26.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2RRB7 | 7-140 | ACLPSRQDVTRNFIYFRRFQKHTISRSAVLVYNQIVPFWEKSRLLVRDKQHVLKQIKDLYGKQENLMKQRKRNNAKDQENQKIYCNN… |
| A0A4Y2AXI4 | 3-109 | LSLRESARLVISETVIFWKKARIPFREFQHCIVKLEALYNEWRMLQKHSKRKSETQEQKEQNFKQKLEDLLDIAHSNALIIITIEED… |
| A0A4Y2A874 | 5-163 | None |
| A0A7T8K0X4 | 2-104 | None |
| T1EUQ1 | 1-200 | None |
| A0A834Y124 | 1-139 | None |
| A0A4Y2CCZ9 | 2-212 | None |
| A0A4C1U6C0 | 15-144 | None |
| A0A4C1UTG1 | 30-160 | None |
| A0A4Y2A693 | 3-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.