DPCstruct | MC22323
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 177 ± 25 aa |
| Standard deviation of domain lengths | 24.57 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 80.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 22.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11238 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365PBL4 | 1-140 | MSFSVEAVREDDYRADEITVEITPEPRFAASDLLWQLTIRILISIDPPEQGWDRYGDIYSNIADPGAWAKRREALATLVTAGDLALS… |
| A0A1F2EUL9 | 4-196 | REWVAETLTKHELRLQREITAALHELTDDNGGDRRLQVPNPLHEINPEKQPNEKLFEMQISIAFDEKLGSVEITANFVGDVHSQAGR… |
| A0A4Y9F1W1 | 1-139 | None |
| A0A4Y8R7T3 | 189-380 | None |
| A0A3S4UWI2 | 97-289 | None |
| A0A8B3FJD3 | 13-169 | None |
| A0A1L7D198 | 90-287 | None |
| A0A086ZE13 | 149-344 | None |
| A0A1S1ECK1 | 5-133 | None |
| A0A8B2EBU3 | 140-325 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.