DPCstruct | MC2232
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 163 ± 15 aa |
| Standard deviation of domain lengths | 15.38 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 18.31 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839IVI1 | 297-458 | DFLKQINTVDDFFDLSNYSLLGGYFSVRECKFIIVNINSSSPEFFWINTKKYKYHYVFFRDVLKKEITLKEFDDITYFEKNKNNISG… |
| A0A2V5W6X7 | 122-263 | KTEESDWKNQIRTPDDPFANWTAQTVGWVKFAILLDQPRRVIFQDSIKYPFHYDFALNRLPAFKGMSSEEFYRVSMRRDNQRVVLGA… |
| A0A6N1YGR0 | 3-141 | None |
| A0A7V7D7I7 | 1-175 | None |
| A0A6B1P7J0 | 1-177 | None |
| A0A2V8TB29 | 7-186 | None |
| A0A2D6SUS8 | 474-639 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.