DPCstruct | MC22319
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 77 ± 7 aa |
| Standard deviation of domain lengths | 7.31 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 27.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A382DQ88 | 1-76 | MTEDVVDQLRSVVKKKKEADIKFKSGTSVPIDPESANIILKTFDTLNSSKKKKMQDNMNKDTKSFLKILDFAFSNA |
| A0A1Z9UM91 | 95-170 | LAEDNLNVLRSIVKSKQNKPVKMKDGSMKVDLFTASAITKVYDAIKQSSNKEKFDRMLNGTKAQFLKIAEFSMSQV |
| A0A1Z8SRN0 | 371-460 | None |
| A0A2E1RPU7 | 107-179 | None |
| A0A3R7SID2 | 81-148 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.