DPCstruct | MC22308
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 118 ± 19 aa |
| Standard deviation of domain lengths | 18.80 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 72.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 46.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183C2S6 | 6-122 | NFVCDDVLFEVFAFCGHFELGLKVALISDRFDRLVDAHFKLREWSLGQLAIRRAADGTGAEIVKHVSNGAERCVERRLSIPQNPLPD… |
| A0A183CT14 | 1-125 | MSDNPRKAQKQLKESFVCDDVLFGVFKFCGPFELGLKVALLSDRFDFLVDAHFNSMEWSLGHLDICRGKKGNGAKIVKRFDRGHKVE… |
| A0A183BUQ3 | 25-157 | None |
| A0A183BUS3 | 53-177 | None |
| A0A183BVJ7 | 1-108 | None |
| A0A183BXE1 | 1-122 | None |
| A0A183BYY1 | 24-178 | None |
| A0A6V7U0H0 | 1-164 | None |
| A0A183BZS4 | 146-271 | None |
| A0A183BTC7 | 125-245 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.