DPCstruct | MC22304
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 12.44 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 89.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 50.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183CP81 | 1-90 | MIHENDYYTKNGEFRIDKEGSATMLNCLMYKLCYHRFGAVHTEHGRPTGYDRVRHAEIGNKNFDLRHLEEAYTSEHWIVRVFRVLKP… |
| A0A0N4US64 | 48-147 | MRISASVHTGAHIKDDDYMSDYGQFRCDEYGKSKYHESLIYRLSYQNFGKVYNRRMNMYGFDEARKMEVYHKNISLQYFEEAYTTTN… |
| A0A183AY67 | 29-126 | None |
| U6MQC8 | 345-436 | None |
| A0A453FEN4 | 67-159 | None |
| A0A183HNI0 | 3-102 | None |
| A0A7J6SI50 | 484-588 | None |
| A0A2T7PF01 | 918-1017 | None |
| A0A183NJQ6 | 79-176 | None |
| A0A7C9EA48 | 165-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.