DPCstruct | MC22302
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 108 ± 10 aa |
| Standard deviation of domain lengths | 9.97 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.48 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 37.80 |
| Pfam Score | 93.75 |
| Assigned Pfam label(s) | CL0213- PF00909 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183CKQ6 | 1-121 | MMAIFFLLIERHFIQRRQFAVLASVFQSLFVVLFASFGEFHNHEEDKHNRVHANYPMFQDIHTMVIIGFGFLLSFLKKYGFSALSIN… |
| A0A060WBL3 | 18-138 | TNIRLTLPVVCFVWQIAMIILFGVFIRYDEESDTHWVETKAHDNITSDIENDFYFRYPSFQDVHVMIFVGFGFLMTFLKRYSFGAVG… |
| A0A2J8L696 | 7-121 | None |
| A0A7J7KJQ8 | 1-105 | None |
| W2SQB9 | 2-91 | None |
| A0A813SEJ2 | 56-160 | None |
| A0A4X2K8R0 | 1-108 | None |
| A0A3R7PJX8 | 8-120 | None |
| A0A3M0JAE0 | 10-107 | None |
| A0A6A3FGZ7 | 34-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.