DPCstruct | MC2230
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 113 ± 4 aa |
| Standard deviation of domain lengths | 4.38 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 86.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 67.38 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5D2KIH6 | 50-163 | MPPPSGILHGTIIDQFITCGKSRDVAHELASQIWLAVLDNLEENQHTFLLLKRLALEGDVFLPFPYSRSIKVQWRVFEKLFTDFRDC… |
| A0A1R3H5C3 | 1-120 | MPPPSGVLHGTIIDQFIACGNSRDIAHELASQIWLAVLDNLEENHHTFLLLKRLALEGDVFLPYPYSRSIKVQWRVFEKLFTDFRDC… |
| A0A453L5T9 | 46-148 | None |
| A0A151SGN5 | 1-114 | None |
| A0A7J0FFC2 | 247-358 | None |
| A0A2K1KSS1 | 207-320 | None |
| B9G4D4 | 194-301 | None |
| A0A199W368 | 145-258 | None |
| A0A7J6WNV8 | 288-399 | None |
| A0A444ZB30 | 401-514 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.