DPCstruct | MC223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 359 ± 47 aa |
| Standard deviation of domain lengths | 46.84 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V9YQ17 | 188-532 | YNISRVGLLVLGCCAAFRNDDARLTAWGRVRAIGILFLRLPAQVIIYGSWFPVVLFVTAHAIDCPIMYLLIYRAFSTVNGDLVISWD… |
| T0Q0R9 | 2-341 | YNIGRAIALFIGCYAARCAEASYKHASLQRRLYAALTMYLRIPAQVVIYGSWLPVLVFVLAHLVDSPFLYFTIFIDLATINGTYYLD… |
| A0A2P4X6M8 | 200-596 | None |
| A0A485KUK1 | 138-426 | None |
| A0A485KF68 | 1-280 | None |
| K3WCD3 | 651-1069 | None |
| A0A1V9YII0 | 1-300 | None |
| A0A485LMV3 | 339-702 | None |
| A0A662YE64 | 457-860 | None |
| A0A5D6YI49 | 220-632 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.