DPCstruct | MC22299
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 235 ± 25 aa |
| Standard deviation of domain lengths | 25.41 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.49 |
| Mean fraction of residues predicted as intrinsically disordered | 0.71 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 25.38 |
| Pfam Score | 73.61 |
| Assigned Pfam label(s) | PF08703- PF06631 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183CHZ7 | 1-284 | MFVWFSLFLHPSARPFDIFQQQVEWINIADLRREKLFLKLQKKLAKEWVEMKNKHQKSRENVQKQQQSSVDRLVKRNHLNSTSLGER… |
| A0A7M3Q8N2 | 1-239 | MLRNDKNYRKLVKKQAKDLEMLRRRHEKEASTMLRAHTILTDKLNAAHAKASSGHRGAPQKSNGVNSPLKDLHKSEMSDLVRQQTDQ… |
| A0A2D4EQ40 | 348-606 | None |
| A0A814SK86 | 2-217 | None |
| A0A182F5F7 | 907-1158 | None |
| A0A5N4D7V5 | 22-249 | None |
| A0A833RH39 | 63-293 | None |
| A0A4Y2IX25 | 220-400 | None |
| A0A0N4UYD6 | 704-962 | None |
| A0A811L8N9 | 2-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.