DPCstruct | MC22298
Metacluster Properties and Pfam Annotations
| Number of structural domains | 81 |
|---|---|
| Mean domain length (aa) | 104 ± 20 aa |
| Standard deviation of domain lengths | 19.87 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 33.31 |
| Pfam Score | 99.11 |
| Assigned Pfam label(s) | PF04502- CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183CHB6 | 13-109 | YPPDFDPAKIPKAKQPRNRQFIQRVMTPFNMRCNTCNEYIYKGKKFNMRRETAEGESYLGLKIFRFYFRCPNCLAEITFKTDIENVD… |
| A0A0C2TNB4 | 11-106 | FPPDFDPDLIPRRKQPKNSQQVVRLMAPFSMRCNTCGEYIYKGKKFNARKETVDGEDYYGIKIFRFYIKCTLCSAEITFKTDPKNTD… |
| A0A5D2VQD8 | 3-86 | None |
| A0A6D2HK97 | 75-164 | None |
| A0A0C2IS38 | 16-135 | None |
| A0A6A5WRW5 | 140-269 | None |
| M9LVZ6 | 16-112 | None |
| A0A094I2L7 | 15-108 | None |
| A0A139WAV5 | 19-135 | None |
| A0A6A2XRA6 | 1-82 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.