DPCstruct | MC22297
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 66 ± 7 aa |
| Standard deviation of domain lengths | 6.66 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 52.58 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0229 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484KW67 | 18-69 | SNHPILCQFCFGDNPRVTEAPYDNFCKTCARPFTRFRWRPYKDGRYKKTEIC |
| A0A183CF41 | 147-213 | SMSKSSYTYNRKTFEDAEFPILCETCLGPNPYLRMSKDTHGGECKICERPFTTFRWMPGRGARYKKT |
| A0A835JSS1 | 1-66 | None |
| A0A0V0QD81 | 1-69 | None |
| R1EQ39 | 1-69 | None |
| U6LIH2 | 1-77 | None |
| A0A484MDW7 | 19-72 | None |
| A0A834ZL78 | 3-65 | None |
| A0A7R9MS02 | 1-57 | None |
| A0A816ZHU5 | 31-83 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.