DPCstruct | MC22293
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 148 ± 15 aa |
| Standard deviation of domain lengths | 14.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M9JWY9 | 14-163 | NNKSKEYWRTALYIPYLTFSTYSETGAELTKSGKKVEKLLKAYGIQNKNDNEDSDMATGNDSRRIIHSSRTLDQFYYHSLKDTKSRD… |
| U7PS92 | 621-755 | KVVLFMPFLHYETDERRQRMTHAINLVRDGWDPPVGSPRDIMLTKGYLCNTPPLHPRRTLDQFFYHGIDTSIRDTDQVVYRYCKRHN… |
| A0A6A6RDQ6 | 143-292 | None |
| A0A2B7XIH8 | 154-270 | None |
| A0A4S3JW33 | 60-230 | None |
| A0A2J6TFB5 | 146-296 | None |
| A0A2J6TG17 | 38-202 | None |
| A0A2V1BFL1 | 7-156 | None |
| A0A7C8ML03 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.