DPCstruct | MC22292
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 73 ± 10 aa |
| Standard deviation of domain lengths | 9.50 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 57.62 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06999 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A2Z5U9 | 86-159 | GLISHVGGHKYAGNVIVYIPPGMTSNPLAGKGIWYGRIEPKHVEGVVSETVLGGKVLVDHFRGGIGEDGEILRL |
| A0A5M9JV75 | 1-85 | MKTARVGLISHIGGHKFAGNVILYIPPDTTTMNGEAHPLAGCGVWYGRVESRHIEGIVQKTILEGKVIEEMFRGGVRQGGEILRI |
| A0A1Y2GT46 | 159-216 | None |
| A0A6G1NT89 | 196-270 | None |
| A0A6A5RI09 | 133-193 | None |
| A0A2P7YQ05 | 606-676 | None |
| A0A399HVL6 | 71-141 | None |
| A0A2N3MYN0 | 72-158 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.