DPCstruct | MC22291
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 233 ± 38 aa |
| Standard deviation of domain lengths | 38.46 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 75.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A367JJV2 | 128-387 | MQPIAYHIYFSSSQYVSDHEKVSIALYVSAGYLVLIFIGSWYLYHNRTLVNRATLQQQTVLKVLLFILFELILFPTLCGFFLDLSTL… |
| A0A444T935 | 329-511 | LCGYCVVGIVLVILHAFAALIKLNRSKRVLGLCYIVVKVALLSVVEIGVFPLVGGWWLDICSLSLFDVTLKDRETSFNIAPGTSMFI… |
| A0A0F4YSW3 | 546-785 | None |
| K3WHR2 | 31-234 | None |
| A0A7M7GFY8 | 363-623 | None |
| A0A836D968 | 50-224 | None |
| U7PSI9 | 1213-1446 | None |
| G0S8R7 | 430-654 | None |
| A0A3B6KQN6 | 125-362 | None |
| A0A0B2VJ42 | 30-349 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.