DPCstruct | MC22290
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 259 ± 41 aa |
| Standard deviation of domain lengths | 40.80 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 22.52 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A512UJL7 | 332-549 | LRRISYLILISPKDFFVKNLDEIIGRLSTALNSSCPALYKRESLTVFRALSLRFSEGHLLPYWSLVIQNLVEVFSDALSKNAKQFSG… |
| A0A5M9JRF2 | 2-247 | ATLVLATMDDNFVTDLPVMQEKIVELLSATPTSSPSSTTRADIYLLLRALVLKTSAIHLATLWPIINAELHVAISSVVAPDHSTPSD… |
| A0A0M8N4A4 | 616-854 | None |
| R1GI71 | 6-282 | None |
| A0A175VU61 | 1635-1887 | None |
| L1IK65 | 23-278 | None |
| A0A7S0FZL0 | 12-313 | None |
| A0A6V7U9I6 | 1-313 | None |
| U9SFK6 | 149-384 | None |
| A0A4V1IPG7 | 6-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.