DPCstruct | MC2229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 123 ± 13 aa |
| Standard deviation of domain lengths | 12.65 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 32.12 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5B8MKZ8 | 321-425 | LETQRVVLQLQEDARSVGTGDDPPVVLGKIPKTFSDNNADKLRPGQLFRFNLGPRGFDFGADGRPMGASLELAGLSHKRAKGDIISR… |
| A0A1R3H551 | 53-174 | TQQQVVLELQDNGKLVTSDDPPVVFGCLDADYMIQQSGLDSGNLLRFAIGDGGLSFSDGKLDKADLNYLGKSNRARAFADSYSKVLF… |
| A0A7S2P771 | 39-166 | None |
| I0Z5Q0 | 176-291 | None |
| A8JF73 | 291-403 | None |
| A0A7S0AFU8 | 101-224 | None |
| A0A7C9E2P4 | 1-149 | None |
| A0A7I8IRZ3 | 128-254 | None |
| A0A086LYT2 | 414-566 | None |
| L1JD62 | 207-324 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.