DPCstruct | MC22289
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 110 ± 11 aa |
| Standard deviation of domain lengths | 11.26 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 44.49 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E4ZP02 | 1-95 | MLTRLDSIKSAAKALAANLRSYYTGDRPGDVPGNLPDPYFWWEAGAMFNAFIDYWYYTGDDQYNEITSQAMQHQIGDFNAFMPPNQT… |
| A0A1V6UV23 | 1-109 | MHILPTYYDQWLTSKNPESIKAAAKTAAAGMLRYYVGDHPGDVSGNIPDPYYGWEAGAMFGAMVEYWYYTGDDKWNEITTQALLQQL… |
| A0A2C5YNC2 | 1-91 | None |
| A0A179I9L5 | 1-112 | None |
| K2SI42 | 18-122 | None |
| A0A2I0S4A9 | 15-119 | None |
| A0A0G4KQJ4 | 1-120 | None |
| A0A420IXF1 | 1-117 | None |
| A0A094FN96 | 2-126 | None |
| A0A420YGU6 | 20-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.