DPCstruct | MC22287
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 345 ± 57 aa |
| Standard deviation of domain lengths | 56.60 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W7E9Y7 | 9-269 | LPVELLQHIFIESGCSLTLLQTAPYIATRLSSEYIYNCTCDYYLTEVHGEHGKQSAAQTYIFASKWMTWDFFKSWCLRRFGPQGCLC… |
| A0A5M9JNG1 | 29-421 | RPRGRPLKLKSSKLMSHTSQSLSSAPREPKTRTMKNIKSKRKMSQLEKLPTELLETIFLYCLNLSLPACSPVIGGKLSSEPVFSKTI… |
| A0A1V8ST11 | 10-360 | None |
| C1H1C4 | 7-399 | None |
| A0A6A6GCQ1 | 1-302 | None |
| A0A6S6VAK4 | 3-274 | None |
| A0A168A8R2 | 47-393 | None |
| A0A4U0XJC1 | 423-769 | None |
| A0A2T3B5N2 | 1-261 | None |
| A0A166MZV0 | 43-442 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.