DPCstruct | MC22286
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 204 ± 47 aa |
| Standard deviation of domain lengths | 46.57 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 88.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 34.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A415RR17 | 5-149 | QIKEVLKQADYVLKDNPVLLKMFKQCFVSTIETTLKKVNDNETFVITGDIPAMWLRDSSAQVNHYLPLVSKDQELSDLIAGLINKQV… |
| E5VBE7 | 1-185 | MKNRSISFYILAMVLATGSNAQASDYVLSKDNTHVATTALKYKTKRPLLQDRLFVSQAVEAEIRRIKSELTNPKLAWMFENCFPNTL… |
| A0A813VTN6 | 100-269 | None |
| A0A813VMG3 | 39-296 | None |
| A0A1Z5SVR0 | 16-238 | None |
| A0A146HC95 | 25-245 | None |
| A0A061SHG1 | 220-399 | None |
| C1FZ18 | 513-809 | None |
| A0A1G4MA88 | 23-297 | None |
| A0A0A2K8H3 | 53-236 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.