DPCstruct | MC22285
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 211 ± 18 aa |
| Standard deviation of domain lengths | 18.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U0WT23 | 217-391 | PDSIVDLAASLARDKKVFMDPVFAASLVDDFAVAGHVKAACDLFRLVPNVWLSLCPHLPIALINDPSGHKTGYIYRIFEMLNRDDPT… |
| A0A5M9JLY5 | 95-302 | REFDQIDAVLKQSRMFNLPVNSSILADLVNNMASVNLHAAYDIYMRYCLGNVEPEACAPLIASMIYKRGSKRIWAAFDAPIYAAMPR… |
| A0A2C5XIC9 | 329-528 | None |
| A0A177A8T6 | 1-219 | None |
| A0A6A5VIQ0 | 2-253 | None |
| N1J7C5 | 398-624 | None |
| A0A842Z555 | 5-215 | None |
| A0A2S7P321 | 1-196 | None |
| A0A6G1L315 | 494-696 | None |
| C7YKR8 | 121-342 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.