DPCstruct | MC22284
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 127 ± 11 aa |
| Standard deviation of domain lengths | 11.44 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 85.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 39.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF11885 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5M9JC33 | 1-134 | MWAPTTALHHGYKAVSVPHPLFVDREWPTEYLASIMNGGRNGATGGARTSVFGDREHNLRGMTWFYNTGFAPNLWRRWLGFKVDNEG… |
| A0A0G2FZT8 | 584-722 | AENLKGNHVGSEMAANTVALLHGLKAVYAPMPVFMDRPWNTEQLQKWFNPGPGGTSGGPGSAMGWGREHRFQGTTWYYRAQPPQRLY… |
| A0A179HHV3 | 916-1039 | None |
| A0A1V6X5G5 | 16-137 | None |
| A0A428U816 | 761-900 | None |
| C9SIE6 | 528-666 | None |
| C9S5Y8 | 15-131 | None |
| A0A2H4SKU5 | 963-1088 | None |
| A0A4Q4UZE7 | 875-997 | None |
| A0A0G2HRC5 | 526-630 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.