DPCstruct | MC22283
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 433 ± 92 aa |
| Standard deviation of domain lengths | 91.69 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 76.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 17.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S9DBS3 | 833-1244 | VLNVTAAMPHAGVLAAAKDPVNGIKQPQNSSEGQFDMMVAAPCPAVNVLCVGMNASELKPLIYDMWPGKKFDVEKWSEQEKEVPKWP… |
| A0A5M9JAZ0 | 36-456 | WGDPTTQTWSLSQTISVPAGSLITSVAETIGSHNETSRFQLLVNGEDPPAPQAIAACTGIYYNITNELINGYSSLDDVPLPFIRRDM… |
| A0A4U0XTA6 | 297-658 | None |
| A0A167ZIS4 | 150-527 | None |
| C8VEK0 | 2-483 | None |
| A0A1V8V2P8 | 6-319 | None |
| A0A2V1B379 | 1-266 | None |
| A0A094AA05 | 306-848 | None |
| Q2H7N1 | 269-780 | None |
| A0A395RJ33 | 266-748 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.