DPCstruct | MC22281
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 204 ± 30 aa |
| Standard deviation of domain lengths | 29.97 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 65.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B2WMN5 | 1-208 | MSTVFSSLVRPPKIRSPSTNTQEATSSLASISNYGVEEPDLRDLNAALQALTDIFPNIQPEVFREMLSTFSEESRLQVVTETLLKHG… |
| A0A428QQZ4 | 1-137 | MVFPGLLSSSDRTPSTRGDPDPEYIYDEAQLATAPPERPDLRELNASLEALAAAFPDVQVEVFRELLRNFDGESRLALVADALLKNR… |
| A0A4U0VEM5 | 1-179 | None |
| A0A395J6Z2 | 1-224 | None |
| A0A094HG85 | 1-200 | None |
| A0A1L9UYR9 | 248-480 | None |
| A0A5M8Q0E8 | 1-225 | None |
| A0A4Z1KSS3 | 1-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.