DPCstruct | MC22280
Metacluster Properties and Pfam Annotations
| Number of structural domains | 54 |
|---|---|
| Mean domain length (aa) | 329 ± 47 aa |
| Standard deviation of domain lengths | 46.84 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 76.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 25.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03676 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287XAZ7 | 37-231 | MGAVTLDLRPGLGVGPFTLGMPISDAFAQIEHQPNIYDVVHVKYFDEEPLKLDFVISFPDHGFHLRFDPWSQRLRLIEIFDVKRLQL… |
| A0A5Q7YL97 | 1-393 | MTSTIVPGEGFADFLYLGTSLYDTVATLKSTNHPMQIAYSARKYLESPILITIPTLGLRLTFSSAQCQELQLIEVLNFDMVKFAYNG… |
| A0A0S4JKS5 | 24-395 | None |
| F4QB45 | 126-488 | None |
| A0A7S2RB91 | 32-374 | None |
| A0A182EAS5 | 407-769 | None |
| A0A7J6ZE63 | 539-878 | None |
| A0A0V0U4N7 | 567-913 | None |
| A0A2A2K166 | 852-1203 | None |
| A0A1Y2B9A7 | 459-788 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.