DPCstruct | MC2228
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 126 ± 15 aa |
| Standard deviation of domain lengths | 15.29 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.67 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 39.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A821HY26 | 1-102 | MPKFYCDCCDTYLTHDSPSVRKTHSRAPKHKENVKHCYQKWMGKQAQSLTDKTTAAFQQPPPPSLPGPPLPGMMPAPHMGGLPMMPV… |
| A0A1R3GNV4 | 30-148 | GVRSVKVKIMPRYYCDYCDTYLTHDSLSVRKQHNAGYKHKDKVRIYYQQFEAQQTQSLIDQRIMEHLGQAAAFNQHLNLMPQTQIQR… |
| A0A091DHS3 | 1-94 | None |
| A0A5B0QM47 | 58-192 | None |
| A0A3P8YXU5 | 1-132 | None |
| A0A843UT05 | 226-374 | None |
| A0A146IEB6 | 1-99 | None |
| A0A061D9F1 | 1-135 | None |
| A0A1A8X1Y3 | 31-142 | None |
| A0A654HR11 | 47-178 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.