DPCstruct | MC22279
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 124 ± 26 aa |
| Standard deviation of domain lengths | 26.47 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 87.44 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 27.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A080M5E7 | 81-186 | QTWCHPSLTWASVTPVVLDRHPKRGQRVEDVVADSVEMAGYPRPVDVKLGQFSAFRGAPLAREFSPRSRGCWTHVALAFEQRVAGPL… |
| A0A6P0JXZ1 | 4-142 | LVVGRLEEQPSISSLTDYSVKESQDQKESYCLRSLTPLIFPRYPHKKNGRYQREEEVQRLLEEMGIFSCQSVELLPKQTKFGVKEQF… |
| A0A651ECZ9 | 191-331 | None |
| A0A7V5UKI6 | 300-474 | None |
| A0A843BF44 | 543-651 | None |
| A0A831XD23 | 382-500 | None |
| A0A3B8PTY5 | 1-187 | None |
| A0A7W6RC54 | 70-163 | None |
| A0A847VKF6 | 33-168 | None |
| A0A6L7Y017 | 473-598 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.