DPCstruct | MC22278
Metacluster Properties and Pfam Annotations
| Number of structural domains | 318 |
|---|---|
| Mean domain length (aa) | 270 ± 60 aa |
| Standard deviation of domain lengths | 60.16 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.10 |
| Pfam Score | 81.31 |
| Assigned Pfam label(s) | PF00940- CL0194- PF00067- CL0219- PF00476 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A349NCK7 | 2-286 | KTFVISDLSQIEPRLTAFVAGDTAFLDLIGQGMSPYEAHARQTMGWTGGKLKDEDPELYLLAKVRVLQLGYGSGWFKFAETVKQYGQ… |
| A0A6P0JW15 | 34-310 | ISTFTEGLPTHIHPVTGRMHPDWFQIGARSGRFRCRHPNLQNIPRDKATRSCFTAGEGQVLIKADYSQVELRIMAKVSGDKRMKRAY… |
| A0A202DFW1 | 6-171 | None |
| A0A0F9U4M4 | 657-868 | None |
| A0A1X7U0L7 | 378-713 | None |
| A0A061QUT7 | 23-300 | None |
| A0A378N190 | 14-191 | None |
| A0A1Y5S0I5 | 4-199 | None |
| A0A0G0BAJ1 | 22-251 | None |
| A0A1G5FBH8 | 3-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.