DPCstruct | MC22276
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 237 ± 27 aa |
| Standard deviation of domain lengths | 26.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 36.96 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M1WZK1 | 521-800 | LPQPGELDIPERIQLQRRLESSLLGKALLDAAVALKLILQHQESFVLELADQCWKLQRRDLESQIFVPFIRRLNRELNKVLVTGGIP… |
| A0A6P0JQJ0 | 1-231 | MQLGAQSWGVHRQELVNQVLNPLLEQINQRVNELLSERGLNQDAIAKICWSGGTLPELQPFFQHWLAQKFPQAQILTLAPDPNTSLV… |
| A0A846E3L7 | 1-191 | None |
| A0A6P2AKI1 | 158-383 | None |
| A0A6I5P120 | 1007-1231 | None |
| B5W9A7 | 317-538 | None |
| A0A1Q8ZBZ9 | 318-553 | None |
| A0A6P0XLZ5 | 47-272 | None |
| A0A1Z4G4W2 | 1010-1243 | None |
| A0A846FVP4 | 338-613 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.