DPCstruct | MC22270
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 71 ± 7 aa |
| Standard deviation of domain lengths | 6.76 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 86.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 57.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05392 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P4RCH1 | 10-64 | HQKKTHDFHDKYGNAVLASGATFCVAVRAYTATQTGTEWILSPVGSVTPKEWRDQ |
| A0A3Q0QYL8 | 1-76 | MYRFAKAAVNISGQAVRQVRHGSSVRQDFHSKYGTGLLLSGAVFCTAIWGYVVTSTGMTWNLSPVGKVEPKEWREE |
| A0A7M4EMQ3 | 98-169 | None |
| A0A3Q2Y0Y7 | 9-72 | None |
| A0A3Q1KDC4 | 51-127 | None |
| A0A4W2GRB9 | 103-176 | None |
| A0A2U9B7W5 | 35-109 | None |
| E3TEQ5 | 1-78 | None |
| A0A6P5IDE4 | 42-111 | None |
| A0A669PKW6 | 32-96 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.