DPCstruct | MC22269
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 168 ± 23 aa |
| Standard deviation of domain lengths | 23.10 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 79.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 30.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H1VTH7 | 10-143 | EIPTFLPIMRGTLGLPGARDPEVLEGLDYRPWVRVTTRLQAHLAACAHPLATIEGGLAAKIKEADQEISRLYSQMVDKQRANARHAE… |
| T1J5R9 | 70-228 | GHDIVVVQEANQPEESTENDSELCRLQVIPTFLPIMRGALNIPTMTDVDVLDKLDHGSILNVCSRYQEHLKQCSEVVSTEQNTLATR… |
| A0A5N4A327 | 211-376 | None |
| A0A0C9RQH4 | 101-257 | None |
| A0A0N5D890 | 1-184 | None |
| A0A0N4WBL7 | 5-194 | None |
| A0A0N5AK77 | 34-190 | None |
| A0A6J0INW9 | 10-187 | None |
| A0A132A261 | 11-204 | None |
| L8YDJ3 | 7-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.