DPCstruct | MC22267
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 117 ± 20 aa |
| Standard deviation of domain lengths | 19.54 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.66 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 32.88 |
| Pfam Score | 89.52 |
| Assigned Pfam label(s) | PF20917- CL0040- CL0021 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S6PEH1 | 1-84 | MTVYICPETGDDGNDGSELKPLRTLYQAMIITKSSKGDFLIRTTKDGKQIWEVASKTALKKSWKRYEQEMLKNEKVAAMRRMRQ |
| T1J4E3 | 1-113 | MSLYISEKSGDDISGDGSKDKPLKTLLEAMRRAGKEPFPPFEVYKTDENDKGMISGLGSSVTVSSEIWIREEHKKEDNMKQIEKDGQ… |
| A0A3D8SYN6 | 1-127 | None |
| A0A183MR64 | 1-77 | None |
| A0A564Y7M0 | 21-113 | None |
| A0A819YRX0 | 3-109 | None |
| A0A177VCZ3 | 24-129 | None |
| A0A0R3TF79 | 6-120 | None |
| A0A553NIF9 | 163-282 | None |
| A0A3M7DQR0 | 1-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.