DPCstruct | MC22265
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 141 ± 19 aa |
| Standard deviation of domain lengths | 19.44 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 66.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.88 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 43.05 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0680 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1IUK9 | 7-150 | EIHEQKGNHVLHIRGDSDSDLEALFKSVINPTDTQVSLIVPMRLRKLPKSFFKPPETGSRTPPQQTSTSSRSGLPASGGTTTGLQIH… |
| H2Z0P3 | 10-126 | ITQGHNQIIHVRQDSASELEALFNTVMNPNFKSKSLPMKARNLPKSFFTQPDKPRQTSMYHHGHSHNFHFRSKSSPASLQLMDVGNL… |
| T1HC02 | 4-155 | None |
| A0A4U1ETI9 | 42-192 | None |
| A0A6P3YIV1 | 5-144 | None |
| V4BET5 | 1-145 | None |
| A0A195CJ14 | 1-193 | None |
| A0A818WZ62 | 1-121 | None |
| A0A6I9Z0Y7 | 37-181 | None |
| A0A2G8L677 | 1-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.