DPCstruct | MC22263
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 97 ± 17 aa |
| Standard deviation of domain lengths | 16.62 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0351 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A433D0X7 | 3-90 | KTANPPNRTERQRCWLVRDEYFACLDSCGVLDPVTVDSKPEVKEKAKACLEKKKVYESECIASWVDYFNKRRVLEFRQQEYLKMHNIN |
| T1IML3 | 40-121 | VERGLSVNLMSFPNKEVRTKCWDSRDRYWECLDKNSDDDKICNTFRKMYEGSCPAQWVKHFDRKRQYLQFKDKIQNEGYEPI |
| A0A5B7CN00 | 1-77 | None |
| A0A177VLI8 | 1-118 | None |
| S3BVB1 | 86-212 | None |
| G4TDU3 | 1-104 | None |
| A0A2K6UHS8 | 33-125 | None |
| A0A5S6QSS9 | 226-317 | None |
| A0A2Y9S1R5 | 1-77 | None |
| A0A4Y7N8P9 | 1-75 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.