DPCstruct | MC22260
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 121 ± 11 aa |
| Standard deviation of domain lengths | 11.23 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 89.39 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9NLA8 | 76-199 | MSRFLAKMAFEALFERFCNTVGEKAAYKIISGEHYDRVREWARYGHNFDEWPYHYRAYFPEETLMEHPDTGEWVQFGFGCDLLLTSI… |
| A0A7Y3SDA7 | 1-98 | MEALDPVRRYVRIGEQPSTWGYSRRRLYAHDALFRENSDVYEVLHEFDFVYTEDKRLFFFLAIFGEEYGIDMSDPDAASCFDFLEKQ… |
| A0A7W6X392 | 55-176 | None |
| A0A433BUW9 | 106-232 | None |
| A0A3N0GI63 | 140-268 | None |
| A0A212DV91 | 2-126 | None |
| A0A2E2C9B1 | 3-106 | None |
| A0A318WNP7 | 7-112 | None |
| A0A7R7BY00 | 16-140 | None |
| A0A7Z7HVJ0 | 68-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.