DPCstruct | MC2226
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 199 ± 22 aa |
| Standard deviation of domain lengths | 22.42 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 19.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R3ICN7 | 2-209 | NQLPPFDELNSVGQQLIKISEVEIDLKYSNMELDHQDMVRRNDVIRDLMKLLIGMQRLYLDQISIDAILKWLDINDFELPDAGEIAR… |
| A0A1R3GGR2 | 10-217 | NNQPTLDQLSIKTVNIIKNIQSHLKILFPSQSINDVSKNDNFPHMIEIITFIIALPEDFTSCDSETRGVIKNWLRIPIDNMPPIVAL… |
| A0A1R3ISQ3 | 55-251 | None |
| A0A1R3HIC6 | 11-176 | None |
| A0A1R3L1R9 | 2-199 | None |
| A0A1R3KS24 | 2-218 | None |
| A0A1R3KQY1 | 224-447 | None |
| A0A1R3KMF5 | 7-249 | None |
| A0A1R3K8P8 | 206-372 | None |
| A0A1R3GPC3 | 42-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.