DPCstruct | MC22258
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 96 ± 11 aa |
| Standard deviation of domain lengths | 11.22 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.89 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 67.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A438BRX2 | 107-197 | DNVENTLNKRMDGTQTNLSEKIDNLQYSISRLTNLNTVQEKGRFPSQPHQNPKGIHGVKAYEGESSKVRNVKAMIALRSGKEVELPT… |
| A0A438H9I2 | 38-136 | KIDNVESTLNKKIDGMHNELSQKIDNIQYSISRLTNLNTVNEKGKFPSQPHQNPKGIHDVESKDEDSSKVRDVQAIITLRSGKEVHQ… |
| A0A438F968 | 2-89 | None |
| A0A438FF30 | 1-88 | None |
| A0A438FPV3 | 55-120 | None |
| A0A438FSQ3 | 123-210 | None |
| A0A438DAH2 | 4-99 | None |
| A0A438DH24 | 12-101 | None |
| A0A438DIC4 | 83-190 | None |
| A0A438DLE2 | 1-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.