DPCstruct | MC22255
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 106 ± 10 aa |
| Standard deviation of domain lengths | 10.47 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 47.45 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A803MR12 | 5-115 | LQTNGGGIWDTVLELTKLAQDKNTNPMVWAIQLGSILNSAGLTLPSVELSHLLVSHICWNNNFPITWKFLEKALALKFVPPMLVLAL… |
| A0A438H4Y1 | 3-113 | MASNATLFEERVKEALKRCQERREPPLIWATEMVKCLDSAGLGLPSVELGQVLVSQLCFAHNCPSMWKFLDHALSSRLLSPLHVLSL… |
| A0A6A6M1A2 | 2-107 | None |
| B9FKF5 | 4-137 | None |
| A0A0A0KG79 | 9-125 | None |
| A0A7C8Z352 | 48-149 | None |
| A0A3N7EK35 | 1-98 | None |
| A0A178VLL7 | 9-102 | None |
| A0A4S8IS56 | 5-98 | None |
| A0A2G9HSX0 | 1-95 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.