DPCstruct | MC22252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 79 ± 10 aa |
| Standard deviation of domain lengths | 10.44 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 74.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.64 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0482 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1MF87 | 1-61 | GRCVPQLTRLLACRAYLVPGAADPSADCCSALSSISRDCACSTMGIINSLPSRCNIGQVNC |
| A0A438GRE2 | 24-109 | ATLLLVVALVARTQMAWSQPSACSTQLNNLSVCAPFVVPGAPDSTPSADCCTALQTIDDACMCSTLRIASRLPSHCNLTPVICVSC |
| A0A7J8XRN3 | 16-97 | None |
| A0A6N2M486 | 29-99 | None |
| A0A6J1HUT5 | 12-93 | None |
| A0A0K9RC60 | 5-73 | None |
| M0ZZM8 | 159-222 | None |
| U5DA12 | 2-84 | None |
| A0A835A875 | 25-94 | None |
| A0A804I1T0 | 19-108 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.