DPCstruct | MC22251
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 270 ± 24 aa |
| Standard deviation of domain lengths | 23.95 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.31 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0111- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J3R0C6 | 11-281 | IITFSVVFFTVAVWNLGLTRVPTTGLQLTGHVSFYVDFGREKAIGNVYVLTKIGAANITVYKGSQGNWTYVGLLQVPFSYYSWSQFN… |
| J9FVZ4 | 5-253 | TGGEKISVIEHQTKLTLQKQPVWTRRELFFLAALTLGTAALSLWQLGDFRAPQNPMDAIGVQKSEQIVLEQPADSLWVYTGVTWDGW… |
| A0A1V5LYW2 | 176-454 | None |
| A0A4P6FA85 | 541-856 | None |
| A0A7U6KE92 | 354-622 | None |
| A0A416PQ54 | 2-261 | None |
| A0A838ZZM1 | 99-363 | None |
| A0A524NHN6 | 2-247 | None |
| A0A563BD82 | 17-291 | None |
| A0A6N9PUM0 | 2-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.