DPCstruct | MC22250
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 111 ± 17 aa |
| Standard deviation of domain lengths | 17.31 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 92.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 39.97 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0339 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R6KS31 | 146-256 | EILKSRLILAKESLLHRYGILKKLRVKDLPFVAGQKLMKGAENLEEEDSIEPILRQGTWGIGFIGLAEALTALIGKHHGENDEAREL… |
| J9FRL8 | 3-103 | RHERLSGTLSDAAPILWQYGALARLPKGETIDKLLHSGYSTISLGFAGLYECVRYMTGHSHTDAEATDFALAVMQHMNDKCAEWKAK… |
| A0A091C7Y5 | 12-113 | None |
| A0A090S659 | 330-443 | None |
| A0A496KAP7 | 2-112 | None |
| A0A7C7DS11 | 7-132 | None |
| A0A7X7NW09 | 1-141 | None |
| A0A2X2T2B5 | 8-87 | None |
| A0A0A2W4U6 | 732-843 | None |
| A0A4U9TPX1 | 103-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.