DPCstruct | MC22248
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 79 ± 4 aa |
| Standard deviation of domain lengths | 3.56 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 92.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 47.63 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A447NW45 | 3-79 | GDEYHIVLTLARIWYTLSTGRFTSKDAAADWLLPQLPEDYAATLRAAQREYLGLEQQDWHILLPAVVRFVDFAKTHI |
| A0A7R6KJZ6 | 32-109 | ENEERNIVLTLARIWYSTETGGIVPKDVAAEWVLERLPAEHKPILVEARQAYLGLCKDSLALRADETSAFIGYAKSAV |
| A0A7I0PN22 | 341-417 | None |
| A0A5Q2NBB7 | 136-212 | None |
| D5SKZ3 | 274-358 | None |
| A0A7W0ZCI9 | 1-87 | None |
| A0A6I6HG79 | 180-257 | None |
| A0A699JJX7 | 253-330 | None |
| A0A1P8YVW4 | 114-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.