DPCstruct | MC22240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 169 ± 20 aa |
| Standard deviation of domain lengths | 20.29 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 88.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.87 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0158 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0B8R0J7 | 2-159 | QLKTKVITDASITIQTAAGLSGKPQLVNETNLITSYKGTSFGEMDAAENGQAAYGVQAGNYAYAPLFQADNTSEFALMDVLKALFDI… |
| A0A4R2T1C9 | 1-178 | MIIDQIVSGSNPEQYLTYVPSLIINTYIVTPNTNLILIGRYGDNEYPLCIQYPNTYYFASTFIKPPFSIAFGEMLHKVFESSASMIR… |
| W4VMF1 | 11-164 | None |
| A0A7V6AMM8 | 1-205 | None |
| F7QUH8 | 46-233 | None |
| A0A7C4JSK4 | 25-183 | None |
| A0A495ADN1 | 38-184 | None |
| G4EZV9 | 19-161 | None |
| A0A4Z0JPS8 | 103-290 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.