DPCstruct | MC2224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 474 ± 55 aa |
| Standard deviation of domain lengths | 54.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.59 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J5TRQ9 | 116-607 | YPSAGNGVNLQYYGERSDFENHRSAGKRDFRYLHLLDSPYFYFNGINREATTAENLAAIKRDVYSLMKLLHAKQLSEAHAISQLSNI… |
| C2ENG9 | 91-591 | GTNLQYPLNKEYYQEHKSNFAIIDQRFVDWDNPLVDISGIYIESLTHMFENPNNNGIEDLDTFKIKAAHTIYEQYELFDSNQTDLSY… |
| A0A0R2FXH3 | 5-390 | None |
| A0A5B0X7R5 | 1-377 | None |
| A0A7T3X2C6 | 26-454 | None |
| A0A1E4GLH4 | 235-742 | None |
| A0A2E7E533 | 65-524 | None |
| A0A8B4FQJ6 | 393-859 | None |
| A0A829GBT7 | 13-466 | None |
| A0A7T2U936 | 128-550 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.