DPCstruct | MC22236
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 157 ± 11 aa |
| Standard deviation of domain lengths | 10.75 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 19.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S6Z1H5 | 108-246 | VGTALYRAYCARVLPAVRRLANAWDNPEPPDPYQVASTVLYDLVGHALDGNPPSWCHTVTLDTYLTSHDVKIRDTLHRLWKTRPDLF… |
| A0A658JFC3 | 1-154 | MSKINSSLFQDFTYRMGKRIQDGSEFYTTDDFLATGREIFIEYYKECEMEVPKWFPMKRFNDYDERGKFIWRELYRSHKQAFDIRED… |
| A0A6F9YIL8 | 1-167 | None |
| U2R4S6 | 87-263 | None |
| Q8RAS8 | 17-168 | None |
| A0A1C2A002 | 132-281 | None |
| A0A7C5AA81 | 528-682 | None |
| A0A373YYW0 | 196-349 | None |
| A0A414NV62 | 7-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.