DPCstruct | MC22235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 4.07 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 37.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5C4NBR7 | 1-62 | MDAFHRRFLTHATISTRFGEHRNTILARLKVAGVAPFRPGRQDYGAIYLRQDVEALYARNGR |
| A0A1T2A6H9 | 62-119 | LSTEDIEAFYARFITLRDLAVEHGMNWQALRHELAKRGIAPFSPDGEDYGAVFERDTI |
| A0A318U434 | 11-78 | None |
| A0A2E9HYG4 | 1-69 | None |
| A0A0W7WDX9 | 43-103 | None |
| A0A1B1A581 | 77-141 | None |
| A0A0K0Y816 | 29-84 | None |
| A0A0J5QE89 | 98-162 | None |
| V9W0Z8 | 25-84 | None |
| A0A1X7A6P0 | 626-691 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.