DPCstruct | MC2223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 115 ± 9 aa |
| Standard deviation of domain lengths | 9.15 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.51 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 38.78 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R1P1E7 | 6-115 | KFRQQAPWAIPSNAQFSEDHRVGYRQISFHWEDAGWQYNARWHQQLPTATLITYPSWQLSRVLPGKGFGPAAHQRREEVLVGDQWLP… |
| C2EMT7 | 40-162 | NYFKLRKIAPWFIPLDAKMTLENKQGYRQIKYVWYKNSWRYEARFHTKTPKAQLITYPSWRLDRIRPGKGFGPDHASRIEESLVGTK… |
| A0A1V4SHE7 | 332-452 | None |
| A0A844LPD0 | 566-691 | None |
| A0A660JIV4 | 119-234 | None |
| A0A1M2ZM67 | 771-884 | None |
| A0A378UDQ6 | 146-266 | None |
| A0A242B772 | 1-101 | None |
| A0A1H6LU29 | 951-1073 | None |
| D1AM23 | 380-486 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.