DPCstruct | MC22229
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 80 ± 9 aa |
| Standard deviation of domain lengths | 8.53 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 32.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1K1NEY4 | 1-91 | MKFGEFRKYISKIDRVSICNAETLSYENYQFISQVPDKFDELYLYGIGRIQSEFPLREALDEASAHGYELTEENMDKIIYANCIEIM… |
| A0A415JQC1 | 1-84 | MSRELKYKLADIREYCDRICKISICMKDTLSYENYEHISLVPDTYNEYYVLGFGVIDGEFKDPITKKIDYFPCLEFMLSKDKIA |
| A0A355W297 | 118-186 | None |
| A0A1T4N750 | 1-84 | None |
| A0A1I2T2R4 | 1-74 | None |
| A0A3C1J0Q0 | 2-69 | None |
| F3AFX8 | 1-93 | None |
| A0A412I0R1 | 81-155 | None |
| A0A3R6JG90 | 24-99 | None |
| A0A416Y028 | 3-90 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.