DPCstruct | MC22223
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 40 ± 3 aa |
| Standard deviation of domain lengths | 2.89 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 68.67 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5P1EN96 | 55-93 | RSRMFYGPGGPYALFAGRDASRALALMSFDPNDLTGNLE |
| A0A2G2ZS62 | 13-50 | SKMFYGPGGSYAMFVGRDASRALAQLSFKPEYFNGSLD |
| A0A0E0K2V9 | 13-50 | None |
| A0A5E4E7G9 | 31-71 | None |
| A0A7N0T9E2 | 99-137 | None |
| A0A830B2K5 | 1-36 | None |
| B4FRR4 | 34-79 | None |
| I1L7G8 | 10-51 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.