DPCstruct | MC2222
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 141 ± 21 aa |
| Standard deviation of domain lengths | 20.87 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 82.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 18.90 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A800AGV3 | 4-126 | RIKLYYNSQIDTPWCDVKKLFIQLKKLEEADIPVTMIDTAPMEEKQIFEHYMEATYPSVRKQYRISQIFGSQSKSGQFFGRQQPALL… |
| A0A3N6PFZ0 | 5-170 | SPSPRTVELWIRSFAPATTGPTQERALERLENVESTSGIEATEVRIWGPKVERTERSRRIPQLRRIQERLDSFEAWATRTGRRLEPF… |
| A0A7V1F777 | 1-116 | None |
| A0A5E4IG01 | 2-113 | None |
| C7NW29 | 20-182 | None |
| A0A1H9P3Q1 | 18-139 | None |
| A0A2Z2HU45 | 23-204 | None |
| A0A1I2MXN7 | 15-166 | None |
| A0A2R6FEZ3 | 20-145 | None |
| A0A7T5ULS6 | 1-113 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.